PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0168500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 353aa    MW: 38485.2 Da    PI: 5.6123
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0168500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.1e-16122168148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W+ eEd  l+++v+++G ++W+ Ia+ ++ gR +kqc++rw+++l
   Spipo0G0168500 122 KGQWSVEEDRTLARLVEEHGVRRWSFIAQNLN-GRVGKQCRERWHNHL 168
                      799*****************************.*************97 PP

2Myb_DNA-binding574.5e-18174216145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd +lv+a+ + G++ W+ Iar+++ gRt++++k++w+
   Spipo0G0168500 174 KDTWSEEEDRILVEAHVEVGNR-WAEIARRLP-GRTENSIKNHWN 216
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.208117172IPR017930Myb domain
SuperFamilySSF466894.58E-30120215IPR009057Homeodomain-like
SMARTSM007173.5E-15121170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-27123174IPR009057Homeodomain-like
CDDcd001673.11E-15125168No hitNo description
PfamPF139215.6E-18125182No hitNo description
SMARTSM007171.1E-17173221IPR001005SANT/Myb domain
PROSITE profilePS5129421.696173223IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-21175221IPR009057Homeodomain-like
CDDcd001672.06E-14176219No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MDCPVSKVEP GEEICSLLDA YCYYSGGEDF HCLGTGFSED FHGLFTGNAF YDGGGDEVLP  60
GHLAACVDQT PPPPTILDAT PLATFPPLND VAQDLAAGGE APKRSANRKG GGKSRKRPHV  120
VKGQWSVEED RTLARLVEEH GVRRWSFIAQ NLNGRVGKQC RERWHNHLRP NIKKDTWSEE  180
EDRILVEAHV EVGNRWAEIA RRLPGRTENS IKNHWNATKR RQFARRRHRG SSSRNPRPSS  240
LLQDYIRSLQ PAADPLPPPS SAVATEEVGG GGEQLLLVPM FDLGDVPEFL LDDGGIFSGV  300
AGGGGGAAPL VGYPWGEEAE APPPVLGECD HVKREMDLME MMIAQAGGCF CF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-471202222104C-Myb DNA-Binding Domain
1msf_C3e-471202222104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279033.13e-76PREDICTED: transcription factor MYB98
SwissprotQ9S7L23e-65MYB98_ARATH; Transcription factor MYB98
STRINGVIT_17s0000g08550.t018e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-58myb domain protein 98